---
title: What an AI agent reads on Dra. Sara Mohrbacher · The Direct Index
url: https://directindex.org/r/drasaramohrbacher.com.br/agent-view?format=md
---

[The Direct Index](https://directindex.org/)
[Scanner](https://directindex.org/scan)[Cities](https://directindex.org/cities)[Numbers](https://directindex.org/stats)[Rankings](https://directindex.org/rankings)[Search](https://directindex.org/search)[Guides](https://directindex.org/guides)[About](https://directindex.org/about)

 [Report](https://directindex.org/r/drasaramohrbacher.com.br) · scanned 2026-10-19

# What an AI agent reads on Dra. Sara Mohrbacher

An assistant's crawler fetches the page once, without running JavaScript, and reads the text, the structured data and the links. Below is what it gets from [drasaramohrbacher.com.br](https://www.drasaramohrbacher.com.br/), taken from the copy the scanner kept.

3,989

characters of text without JavaScript

MedicalClinic

structured data for the business

0

of 3 AI crawlers turned away at the edge

 Text

## The words an agent gets

Title: Dra Sara Mohrbacherheartclosemap-markerchevron-leftchevron-rightphonefacebookbarslinkedinyoutube-playinstagramwhatsappmagnifiercrosschevron-down · language pt-BR. First 1,800 of 3,989 characters:

```
Dra Sara Mohrbacher Home Quem Sou Currículo Na Mídia Tratamentos Diabetes mellitus Doença renal crônica Doença renal policística Infecção urinária Insuficiência renal aguda Hipertensão arterial (pressão alta) Nefrite Osteoporose Pneumonia Proteinúria Transplante renal Orientação Atividade física para idosos, por que não? Cálculo de função renal Por que as Vacinas são tão importantes? Queda de idosos: principais causas, prevenção e o que fazer caso ocorra Você sabe a importância do cálcio no seu organismo? Tabelas Potássio em alguns alimentos Tabela de Cálcio Blog Contato Pesquisar por: Agende seu horárioclique aqui para agendarDra. Sara Mohrbacher CRM: 146577 | RQE : 69465 - Clínica médica | 69466 - NefrologiaTem experiência na área de Clínica Médica, Nefrologia e no manejo de pacientes que necessitam de internação hospitalar desde 2012. Aprimorou seus conhecimentos, além das especializações realizadas em universidades públicas, por meio de cursos e treinamentos, como Harvard CME course Nephrology. conheça a dra.Tratamentosdoença renal policísticatransplante renalinsuficiência renal aguda ou crônicaproteinúriaPressão Alta conheça todos os tratamentosExames relacionadosExame de urina de 24horasUltrassom do aparelho urinárioExame de urinaExame de sangueTomografia do aparelho urinário conheça todas os examesorientações ao pacienteBeber muita água cura os rins?14 maio 2026Beber muita água faz bem aos rins? Entenda benefícios, riscos e limites da hidratação para a saúde renal. Clique aqui e saiba mais!Leia o texto completoComo a prática de esportes protege a saúde dos rins?8 abril 2026Esportes ajudam na saúde dos rins? Veja benefícios, prevenç&at
```

 Facts

## What it can say about the business

| A business type in JSON-LD | MedicalClinic |
| Name | Dra. Sara Mohrbacher |
| Telephone | +55-11-91208-7141 |
| Address | yes |
| Opening hours | yes |
| Menu or price list | nothing |
| Cuisine in structured data | no |
| JSON-LD blocks | 1 (Article, GeoCoordinates, ImageObject, ItemList, MedicalClinic, Organization) |

 Actions

## The links it would act on

No booking or ordering link found; only a phone number (+5511973994155). An agent has nothing to act on.

Everything here comes from fetching the homepage once as a crawler. The [report](https://directindex.org/r/drasaramohrbacher.com.br) turns it into a score and a list of fixes, with code to paste.

#### The Direct Index

[Why direct](https://directindex.org/why)[What agent-direct means](https://directindex.org/agent-direct)[About and principles](https://directindex.org/about)[Methodology](https://directindex.org/methodology)[Privacy](https://directindex.org/privacy)[Terms](https://directindex.org/terms)[Corrections](https://directindex.org/corrections)[Legal notice](https://directindex.org/legal)

#### Use it

[Free scanner](https://directindex.org/scan)[City indexes](https://directindex.org/cities)[Search the index](https://directindex.org/search)[Rankings](https://directindex.org/rankings)[What assistants recommend](https://directindex.org/assistants)[Ask the index](https://directindex.org/ask)

#### Vendors and help

[Booking and ordering vendors](https://directindex.org/vendors)[Which vendors' terms allow agents](https://directindex.org/vendors/terms)[Vendor verification](https://directindex.org/vendors/verification)[Website builders](https://directindex.org/builders)[Who can fix this](https://directindex.org/providers)[For agencies](https://directindex.org/agency)

#### For agents

[llms.txt](https://directindex.org/llms.txt)[llms-full.txt](https://directindex.org/llms-full.txt)[OpenAPI](https://directindex.org/openapi.json)[MCP server](https://directindex.org/.well-known/mcp/server-card.json)[A2A agent](https://directindex.org/.well-known/agent-card.json)[Direct feeds](https://directindex.org/direct.json)

#### Data

[Open data, CSV and JSON](https://directindex.org/data)[The quarterly edition](https://directindex.org/editions)[City data, JSON and Markdown](https://directindex.org/cities)[Sitemap](https://directindex.org/sitemap.xml)

Business listings come from OpenStreetMap contributors, under the ODbL. Scores are published under the same licence.

```json
{"@context":"https://schema.org","@graph":[{"@type":"Organization","@id":"https://directindex.org/#org","name":"The Direct Index","url":"https://directindex.org/","logo":"https://directindex.org/favicon.svg","email":"hello@directindex.org","founder":{"@type":"Person","@id":"https://directindex.org/#antonio","name":"Antonio Curado","sameAs":["https://x.com/ab_curado"]},"description":"Independent measurement of whether AI agents can find, read and act on a business's own website."},{"@type":"WebSite","@id":"https://directindex.org/#site","url":"https://directindex.org/","name":"The Direct Index","publisher":{"@id":"https://directindex.org/#org"},"inLanguage":"en","potentialAction":{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https://directindex.org/scan?url={url}"},"query-input":"required name=url"}},{"@type":"WebAPI","name":"The Direct Index API","url":"https://directindex.org/openapi.json","documentation":"https://directindex.org/llms-full.txt","provider":{"@id":"https://directindex.org/#org"}}]}
```